Query (optional)   in Class  

GrainGenes Sequence Report: AY304482_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
AY304482_1.cds
Peptide
MPGLTIGDTVPNLELDSTHGKIRIHDYVGNGYVILFSHPGDFTPVCTTEL
AAMANYAKEFEKRGVKLLGISCDDVQSHKEWTKDIEAYKPGSKVTYPIMA
DPDRSAIKQLNMVDPDEKDAEGQLPSRTLHIVGPDKKVKLSFLYPSCTGR
NMDEVVRAVDSLLTAAKHKVATPANWNPGECVVIAPGVSDDEAKKMFPQG
FETADLPSKKGYLRFTKV
Structure From Source
AY304482
Source Exons
1657
Corresponding Protein
AY304482_1.protseq
Gene Product
1-Cys-peroxiredoxine
Remark
CDS note: peroxidase; important in detoxification of reactive oxygen species (ROS), which damage nucleic acids, proteins and lipids; conserved catalytic cysteine residue of this peroxiredoxin family subgroup localized in N-terminus of protein; simimlar to Triticum turgidum PER1
DB_xref: GI:34539782
Feature: CDS: function = 'catalyzes reduction of various hydroperoxides'; protein_id = 'AAQ74769.1';
Gene: PER1
Codon Start
1