Query (optional)   in Class  

GrainGenes Sequence Report: AY625683_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
AY625683_1.cds
Peptide
MGMPAVRRRERDAEAELNLPPGFRFHPTDDELVEHYLCRKAAGQRLPVPI
IAEVDLYRFDPWALPDRALFGTREWYFFTPRDRKYPNGSRPNRAAGNGYW
KATGADKPVAPRGGRTMGIKKALVFYAGKAPKGVKTDWIMHEYRLADAGR
AAASKKGSLRLDDWVLCRLYNKKNEWEKMQLQQQGEEETMMEPKAENTAS
DMVVTSHSHSQSQSHSHSWGEARTPESEIVDNDPSLFQQATAAAFQAQSP
AAAAAHQEMMATLMVPKKEAADEAGRNDLFVDLSYDDIQSMYNGLDMMPP
GDDLLYSSLFASPRVRGSQPGAGGMPAPF
Structure From Source
AY625683
Source Exons
1990
Corresponding Protein
AY625683_1.protseq
Gene Product
NAC domain transcription factor
Remark
CDS note: TaNAC2
DB_xref: GI:51702426
Feature: CDS: protein_id = 'AAU08786.1'
Gene: NAC2
Codon Start
1