Query (optional)   in Class  

GrainGenes Sequence Report: CR626929_5.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
CR626929_5.cds
Peptide
MVAMVERWAGLGSAMASIIFLWSMVQNHVPVTLRLYLTTWAAKLAACFSP
YLQITILENSAGRFQQSEFFYAVEAYLSDACASRARRLKAELGSDSSNLQ
VSVDDHEEVTDEFSGVTLWWYASKKHSKGNVISFYPGEDERRFYQVVFHR
SHRDLVVGSYLPFVLAEGRTVIVKNRQRRLFTNCGGRRRRYLRNSVWDYV
KFEHPATFDTLAMDTDQKEAIMDDLIAFKDGKEYYTKVGKAWKRGYLLYG
PPGTGKSTMIAAMANFLDYDVYDLELTSVKNNTELRKLFIEMTSKSIIVI
EDIDCSIDLTGKRRKGKKASSNKDSDNEYEADPTEPQKDDESKVTLSGLL
NFIDGLWSASGGERIIIFTTNHKEKLDPALIRRGRMDKHIEMSYCRFEGF
KVLAKNYLDIVEHVLFGEIQQLLEETDMSPADVAENLMPVSKKKKKDPNM
CLAGLIAALKQAKKDAVEAAAAAKAKEEEEAEAKKAKEKEEPKEDK
Structure From Source
CR626929
Source Exons
11491
Corresponding Protein
CR626929_5.protseq
Gene
213F23_1.5
Gene Product
Cell Division Protein AAA ATPase family
Remark
DB_xref: GI:61656787
[ Show all 10 ]
Codon Start
1