Query (optional)   in Class  

GrainGenes Sequence Report: CR626934_10.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
CR626934_10.cds
Peptide
MAALVERWAGLGSAMASIIFLWSMVQNHIPVTLRLYLTAWAAKLVACFSP
YLQITILENSAERFQQSEFFYAVEAYLSDACAHRASRLKAELGSDSSNLQ
VSVDDHEEVTDEFSGVTLWWYASKKHSKGNVISFYPGEDERRFYKVVFHR
SHRDLIVDSYLPFVLAEGRAVIVKNRQRRLFTNCGGRRRRYLRNSVWDHV
KFEHPATFDTLAMDTDQKEAIMDDLIAFKDGKEYYTKVGKPWKRGYLLYG
PPGTGKSTMIATMANFLDYDVYDLELTSVKNNTELRKLFIEMTSKSIIVI
EDIDCSIDLTGKRRKDKKASSNKDSDNEYEPDPTEPRKDDESKVTLSGLL
NFIDGLWSASGGERIFIFTTNHKEKLDPALIRRGRMDKHIEMSYCRFEGF
KVLAKNYLDIVEHVLFGEIRQLLEETDMSPADVAENLMPMSKKKKKDPNM
CLAGLIAALKQAKKDAVTTAAVAKAKEEEEAEAKKAKEKEEPKEDK
Structure From Source
CR626934
Source Exons
11491
Corresponding Protein
CR626934_10.protseq
Gene
1611A10_1.10
Gene Product
Cell Division Protein AAA ATPase family
Remark
DB_xref: GI:61656810
[ Show all 9 ]
Codon Start
1