Query (optional)   in Class  

GrainGenes Sequence Report: CR626934_4.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
CR626934_4.cds
Peptide
MKALFLIGLLALVASTAFAQYSEVVGSYDVAGGGGAQQCPVETKLNSCRN
YLLDRCSTMKDFPVTWRWWKWWKGGCQELLGECCSRLGQMPPQCRCNIIQ
GSIQGDLGGIFGFQRDRASKVIQEAKNLPPRCNQGPPCNIPGTIGYYW
Structure From Source
CR626934
Source Exons
1447
Corresponding Protein
CR626934_4.protseq
Gene
1611A10_1.4
Gene Product
Pina Puroindoline-a
Remark
DB_xref: GI:61656807
[ Show all 8 ]
Codon Start
1