Query (optional)   in Class  

GrainGenes Sequence Report: D13472_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
D13472_1.cds
Peptide
MAILGELGTEILIPVCGVIGIVFAVAQWFIVSKVKVTPGAASAAAGAKNG
YGDYLIEEEEGLNDHNVVVKCAEIQTAISEGATSFLFTMYQYVGMFMVVF
AAIIFLFLGSIEGFSTKGQPCTYSKGTCKPALYTALFSTASFLLGAITSL
VSGFLGMKIATYANARTTLEARKGVGKAFITAFRSGAVMGFLLSSSGLVV
LYITINVFKMYYGDDWEGLFESITGYGLGGSSMALFGRVGGGIYTKAADV
GADLVGKVERNIPEDDPRNPAVIADNVGDNVGDIAGMGSDLFGSYAESSC
AALVVASISSFGINHDFTAMCYPLLVSSVGIIVCLLTTLFATDFFEIKAA
NEIEPALKKQLIISTALMTVGVAVISWLALPAKFTIFNFGAQKEVSNWGL
FFCVAVGLWAGLIIGFVTEYYTSNAYSPVQDVADSCRTGAATNVIFGLAL
GYKSVIIPIFAIAVSIYVSFSIAAMYGIAMAALGMLSTMATGLAIDAYGP
ISDNAGGIAEMAGMSHRIRERTDALDAAGNTTAAIGKGFAIGSAALVSLA
LFGAFVSRAGVKVVDVLSPKVFIGLIVGAMLPYWFSAMTMKSVGSAALKM
VEEVRRQFNTIPGLMEGTAKPDYATCVKISTDASIKEMIPPGALVMLTPL
IVGTLFGVETLSGVLAGALVSGVQIAISASNTGGAWDNAKKYIEAGNSEH
ARSLGPKGSDCHKAAVIGDTIGDPLKDTSGPSLNILIKLMAVESLVFAPF
FATYGGLLFKYI
Structure From Source
D13472
Source Exons
12289
DB Remark
3.6.1.1
Corresponding Protein
D13472_1.protseq
Gene Product
inorganic pyrophosphatase
Remark
DB_xref: GI:6012172
Feature: CDS: protein_id = 'BAA02717.2';
Codon Start
1