Query (optional)   in Class  

GrainGenes Sequence Report: DQ013357_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
DQ013357_1.cds
Peptide
MAPPAKLTQYTQLILLLLAAAVASDHLTLHQAAAAADELQGRPQQGLGRP
GCRDKCGDMSIPLPFGMDKPGCFLPGFEVTCNTSSTPPRAFLAYNHSQPP
YQHIYQYAFNTEGGATSQIEGRQAVELFDISLETSEVRVYSGANSRCFTN
ESAGLDKGEYMELDREGPFLLSSTRDDLVGVGWNAEPSMTYTVKTSPDPL
SCTSNDPFMSATDGECSGLGCCQIALRPQISTLPVISTGVILKNYINIRW
ETNPCSYGMVVERSWYNFTEEDLYGHEVLSTKLSRGFPLVLDFAIRDGSC
ERDGCLSGNSSCAIAAGGYVCKCREHYNGNPYITVGCQDIDECQLREQSP
EFRDLYPCDGICTNIPGGYDCRCKRGMKGDAKKGTCAEIFPLSAKIIVGL
AGLIVVFVIIVMAKQHLKLKKFYAQNGGPILNGVKNIRIYTRKQLKQVTN
NYECVIGQGHFGKVYKGTLKDKQQVAVKKSIKVDKDMKKEFTDEVIIQSE
MRHKNIVRLLGCCLEFDVPVLVYEFVAKGSLYDVLLKRKDSIPVNKRLAI
AIGSAEGLTYMHSAGESTIRHGDVKSANILLDEHSTPKVSDFGTSKLLAK
GKDEETDRVIGDMSYIDPIYMEKGVITQKSDVYSFGIVLIELITRRPATY
DVKRSYVANFVQSCAEKRVRNFIDNDITSEVDIAMLEMVSGVAADCLKPN
PEEWHDMKQVEHRLLKIIGQPVYHGQKGNSQLDLRPAPDHVALLS
Structure From Source
DQ013357
Source Exons
11015
11551334
20083050
Corresponding Protein
DQ013357_1.protseq
Gene Product
wall-associated kinase 2
Remark
CDS note: putative; TaWAK2
DB_xref: GI:63175644
Feature: CDS: protein_id = 'AAY34781.1'
Gene: WAK2
Codon Start
1