Query (optional)   in Class  

GrainGenes Sequence Report: DQ013359_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
DQ013359_1.cds
Peptide
MDRLPSGGQTLLLLVVATLTLQHSATAYESESSGSIRMARPDCPDKCGSV
SIPYPFGTGKGCFQEPFDVTCNATGPYLASTRVRILDINLAMGEIRVLNP
HIAWECNYTNGTNSSGSDGLTLDPFHKLSNTKNKLISIGCATLGLILGAT
KGKNQLEFPIVNTCFSFCTDASSVDDSKECIGMGCCQTPFPGNISSFNTG
SAPLPSLYNSTNQSFSPCSYSFVTEEDWFKFDRSYVSSTNFATKYTDGVP
LVLDWVVGNKSCSEATKMGSQYACQAKNSQCINVSNGPGYRCNCSQGYEG
NPYLQGGCQDINECEPPNQSLYPCQGKCTNTVGNYTCFCPSGFRSDDPKS
IPCVPADPKKALKVVLGISFSAIFLMVCIFALRAEYQKRKLAKEKDKFFD
QNGGQILYRQIMSKQVDTLKIFTQEDLKKVTNDFDKSRELGRGGHGTVYK
GILKDDRVVAVKRSKIMNVTETDEFVQEIIILSQTDHRNVVRLLGCCLEV
EVPILVYEFIPNGTLFEFIHRSYGSPPPSLDTRLRVAQESAEALAYLHLS
MNHPIVHGDVKSMNILLDENYMAKVTDFGASRTLPKDAAQFMTLVQGTLG
YLDPEYLQERQLTEKSDVYSFGVVLLELITGKTAIYNDGPKEGKSLVWSF
LLAMKEDSLEDILDPSIVRAGTETLLGEVAELGRMCLGPIGEERPSMTQV
ADRLKALRSTWREELVLDRAVTEHMVVHMPPVAAPMPWDLASSSSGAPST
VPYMSGMGIEAPRWYSFI
Structure From Source
DQ013359
Source Exons
122
25113416
35343704
38765083
Corresponding Protein
DQ013359_1.protseq
Gene Product
wall-associated kinase 3
Remark
CDS note: putative; TaWAK3
DB_xref: GI:63175650
Feature: CDS: protein_id = 'AAY34783.1'
Gene: WAK3
Codon Start
1