Query (optional)   in Class  

GrainGenes Sequence Report: DQ022842_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
DQ022842_1.cds
Peptide
MPMGSSSAAMPALPPGFRFHPTDEELIVHYLGRQAASMPSPVPIIAEVNI
YKCNPWDLPGKALFGENEWYFFSPRDRKYPNGARPNRAAGSGYWKATGTD
KAILSTPANESIGVKKALVFYRGKPPKGVKTDWIMHEYRLTAADNRTTKR
RGSSMRLDDWVLCRIHKKCGNLPNFSSSDQEQEHEQESSTVEDSQNNHTV
SSPKSEAFDGDGNDHLQLQQFRPMAIAKSCSLTDLLNTVDYAALSHLLLD
GAGASSSDAGADYQLPPENPLIYSQPPWQQTLHYNNNNGYVNNETIDVPQ
LPEAGVDDYGMNGDKYNGMKRKRSSGSLYCSQLQLPADQYSGMLTHPFLS
QQLHM
Structure From Source
DQ022842
Source Exons
11068
Corresponding Protein
DQ022842_1.protseq
Gene Product
NAC domain transcription factor
Remark
DB_xref: GI:66275772
Feature: CDS: protein_id = 'AAY44097.1'
Gene: NAC69-2
Codon Start
1