Query (optional)   in Class  

GrainGenes Sequence Report: DQ022843_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
DQ022843_1.cds
Peptide
MPMGSSSAAMPALPPGFRFHPTDEELIVHYLGRQAASMPSPVPIIAEVNI
YKCNPWDLPGKALFGENEWYFFSPRDRKYPNGARPNRAAGSGYWKATGTD
KAILSTPANESIGVKKALVFYRGKPPKGVKTDWIMHEYRLTAADNRTTKR
RGSSMRLDDWVLCRIHKKCNNLHNFSSSDQEQEHEQESSTTVEDSHNNHT
VSSPKSEAFDGDGDDQLQLQQFRPMAIAKSCSLTDLLNTVDYAALSHLLL
DGAGAGASSSDAGADYQLPPENPLIYSQPPWQQTLHYNNNNNGYVNIDTI
DVPQIPEARVDDYGMNGDRYNGMKRKRSSGSLYCSQLQLPADQYSGMLIH
PFLSQQLHM
Structure From Source
DQ022843
Source Exons
11080
Corresponding Protein
DQ022843_1.protseq
Gene Product
NAC domain transcription factor
Remark
DB_xref: GI:66275774
Feature: CDS: protein_id = 'AAY44098.1'
Gene: NAC69-3
Codon Start
1