Query (optional)   in Class  

GrainGenes Sequence Report: DQ151537_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
DQ151537_1.cds
Peptide
KNLMAERRRRKKLNDRLYMLRSVVPKISKMDRASILGDAIDYLKELLQRI
SDLHSELESAPSSAALGGPSTANTFLPSTPTLQPFPGRIKEERCPPAPFP
SPSGQQATVEVRMREGQAVNIHMFCARRPGILLSTMRALDSLGLDIEQAV
ISCFDGFAMDVFRAEQCREGPGLLPEEIKAVLLHCAGLQNAM
Structure From Source
DQ151537
Source Exons
1580
Corresponding Protein
DQ151537_1.protseq
Gene Product
inducer of CBF expression 2
Remark
CDS note: HvICE2
DB_xref: GI:75706692
Feature: CDS: protein_id = 'ABA25897.1'
Gene: ICE2
Codon Start
2