Query (optional)   in Class  

GrainGenes Sequence Report: DQ862061_1.cds

Sequence
DQ862061_1.cds
Peptide
MDLVNGALNWAAMPAMVAALLLFYPPYYLFKLCYSFLSYLFPDDLKRKVV
LITGASSGIGEQLAYQYAAKGACLALVARKEWSLRQVADRAFDLGAPDVI
ILPGDVADPDDCNRFVQATVDHYGRLDHLVCNAGIASVGAFQEIPDVTNY
SSQLDVNFWGAVQSTSAALPHLKRTRGRIVVTASATGWNPVPRMIFYNAA
NAALINFFETLRSELGSEVGITIVTPGWIESEMSKGKFLKEHGGVEVDQE
YRDAQIGLFPVEYAKNCARAMVQAARQGDRYLTVPSWFGTMYLWRVFAPE
VVEFCYRLLYMHRHGGGDQTDAPSKTMAQGGGKQMLYPSSLRSSDVKSD
Structure From Source
DQ862061
Source Exons
11050
Corresponding Protein
DQ862061_1.protseq
Gene
HSD11BL
Gene Product
11-beta-hydroxysteroid dehydrogenase-like protein
Remark
DB_xref: GI:112784981
Feature: CDS: protein_id = 'ABI20736.1';
Codon Start
1