Query (optional)   in Class  

GrainGenes Sequence Report: EF051701_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
EF051701_1.cds
Peptide
MAKRLVHFVAVVVALVALTVAEGEASGQLQCERELQERELKACQQVMDQQ
LRDISPKCHPVVVSPVAGQYEQQIVVPPKGGSFYPGETTPPQQLQQSIFW
GIPALLKRYYPSVTSPQQVSYYPGQASPQRPGQGQQPGQGQQSVQEQQGY
YSTSPQQPGQWQQPEQGQPGYYPTSLQQPGQLQQPAQGQQGQQSGQGQQG
QQPGQGQPGYYPTSLQLQPGQLQQPAQGQQGQQPGQGQQGQQSGQGKQSG
QGQQGQQPGQGQQGQQLGQGQGYYPTSLQQSGQGQPGYYPTFLQQPGQWQ
SGYYPTSPQQPGQGQQPEQLQQPAQGQQPGQGQQGQQPAQGQQGQQGQQP
AQGQQGQQPAQGQQGQQGQQPAQGQQGQQGQQPAQGQQPGQGQLGYYPTS
PQQSGQGQPGYYPTSSQQPGQSQQPGQGKQGQQLGQGQQAQQPGQGQQPG
QGQSGYYPTSSQQSGQGQPGYYLTSPQQPGQGQQPGQLQQSAQGQEGQQP
GQGQQGQQPGQGQQGQLPGQGQQGQQPGQGQPGYYPTSPQESGQGQQPGQ
WQQSGQGQPGYYPTSPLQPGQGQPGYNPTSPQQPGQGQQPGQLQQPTQEQ
QGQQLAQGQQPTQGQQGQQPGQGQQGQQPGQGQQGQQPGQEQQPAQGQQG
QQPAQGQQGQQPGQGQQPGQRQPGYYPTSPQESGQGQQPGHWQQPGQGQP
GYYLTSLLQPGQGQQGYYPTSLQQLGQGQQPGQWQQSGQGQQGYYTTSPQ
LSGQGQQLGQWLQLGQGQQPGQWLQPGQGQQGYYPTSPQQSGQGQQPGQW
LQPGQGQQVYYPTSPQQPGQGQQSGQGQQGYYSSYHVSAEHQAASLKVAK
AQQLAAQLPAMCRLEGGDALSASQ
Structure From Source
EF051701
Source Exons
12625
Corresponding Protein
EF051701_1.protseq
Gene
1Dx1.1t
Gene Product
high molecular weight glutenin subunit
Remark
DB_xref: GI:117650737
Feature: CDS: protein_id = 'ABK54357.1';
Codon Start
1