Query (optional)   in Class  

GrainGenes Sequence Report: EF077434_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
EF077434_1.cds
Peptide
SGPWSWCDPATGYKVSALTGCRAMVKLQCVGSQVPEAVLRDCCQQLADIN
NEWCRCGDLSSMLRSVYQELGVREGKEVLPGCRKEVMKLTAASVPEVCKV
PIPNPSGDRAGVCYWAAYPDV
Structure From Source
EF077434
Source Exons
1366
Corresponding Protein
EF077434_1.protseq
Gene Product
monomeric alpha-amylase inhibitor
Remark
DB_xref: GI:134034563
Feature: CDS: protein_id = 'ABO45962.1';
Codon Start
1