Query (optional)   in Class  

GrainGenes Sequence Report: EF095061_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
EF095061_1.cds
Peptide
ELMRVRFSKTRFGEHQAENWWKENREKVYERYNVRTSQRASSAASTHSA
Structure From Source
EF095061
Source Exons
124
414540
Corresponding Protein
EF095061_1.protseq
Gene
11B
Gene Product
11B protein
Remark
DB_xref: GI:126702035
Feature: CDS: protein_id = 'ABO26721.1';
Codon Start
2