Query (optional)   in Class  

GrainGenes Sequence Report: FB814572_1.cds

Sequence
FB814572_1.cds
Peptide
MALLCSALSNSTHPSFRSHIGANSENLWHLSADPAQKSKRRCNLTLSSRA
ARISSALESAKQVKPWQVPKRDWFPPEFMFGAASAAYQIEGAWNEGGKGP
SSWDNFCHSHPDRIMDKSNADVAANSYYMYKEDVRMLKEIGMDSYRFSIS
WPRILPKGTLDGGINHEGIQYYNDLLDCLIENGIKPYITLFHWDTPQALA
DEYKDFLDRRIVKDYTDYATVCFEHFGDKVKNWFTFNEPHSFCGLGYGTG
LHAPGARCSAGMTCVIPEEDALRNPYIVGHNLLLAHAETVDVYNKFYKGD
DGQIGMVLDVMAYEPYGNNFLDQQAQERAIDFHIGWFLEPMVRGDYPFSM
RSLVGDRLPFFTKSEQEKLVSSYDFVGINYYTSRFAKHIDISPEFIPKIN
TDDVYSNPEVNDSNGIPIGPDVGMYFIYSYPKGLKNILLRMKEKYGNPPI
YITENGTADMDGWGNPPMTDPLDDPLRIEYLQQHMTAIKEAIDLGRRTLR
GHFTWSLIDNFEWSLGYLSRFGIVYIDRNDGCKRIMKKSAKWLKEFNGAT
KKLNNKILGASSCCSGVTHGGGTA
Structure From Source
FB814572
Source Exons
11725
Corresponding Protein
FB814572_1.protseq
Remark
CDS note: unnamed protein product
DB_xref: GI:219772369
Feature: CDS: protein_id = 'CAW48570.1';
Codon Start
1