Query (optional)   in Class  

GrainGenes Sequence Report: M13237_1.cds

Sequence
M13237_1.cds
Peptide
PPSVESIGVCYGMSANNLPAASTVVSMFKFNGIKSMRLYAPNQAALQAVG
GTGINVVVGAPNDVLSNLAASPAAAASWVKSNIQAYPKVSFRYVCVGNEV
AGGATRNLVPAMKNVHGALVAAGLGHIKVTTSVSQAILGVFSPPSAGSFT
GEAAAFMGPVVQFLARTNAPLMANIYPYLAWAYNPSAMDMGYALFNASGT
VVRDGAYGYQNLFDTTVDAFYTAMGKHGGSSVKLVVSESGWPSGGGTAAT
PANARFYNQHLINHVGRGTPRHPGAIETYIFAMFNENQKDS
Structure From Source
M13237
Source Exons
1874
Corresponding Protein
M13237_1.protseq
Remark
CDS note: (1->3,1->4)-beta-glucanase isoenzyme II (EC 3.2.1.73)
DB_xref: GI:553044
Feature: CDS: protein_id = 'AAA32962.1';
Codon Start
1