Query (optional)   in Class  

GrainGenes Sequence Report: M62907_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
M62907_1.cds
Peptide
MARKDVASMFAVALFIGAFAAVPTSVQSIGVCYGVIGNNLPSRSDVVQLY
RSKGINGMRIYFADGQALSAVRNSGIGLILDIGNDQLANIAASTSNAASW
VQNNVRPYYPAVNIKYIAAGNEVQGGATQSILPAMRNLNAALSAAGLGAI
KVSTSIRFDEVANSFPPSAGVFKNAYMTDVARLLASTGAPLLANVYPYFA
YRDNPGSISLNYATFQPGTTVRDQNNGLTYTSLFDAMVDAVYAALEKAGA
PAVKVVVSESGWPSAGGFAASAGNARTYNQGLINHVGGGTPKKREALETY
IFAMFNENQKTGDATERSFGLFNPDKSPAYNIQF
Structure From Source
M62907
Source Exons
11005
DB Remark
3.2.1.29
Corresponding Protein
M62907_1.protseq
Gene Product
(1-3)-beta-glucanase
Remark
DB_xref: GI:167010
Feature: CDS: function = 'hydrolysis of beta-(1-3)-glucan'; protein_id = 'AAA32939.1';
Gene: cBGL32
Codon Start
1