Query (optional)   in Class  

GrainGenes Sequence Report: NC_007579_31.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
NC_007579_31.cds
Peptide
MRLLAPAFKFHFKGGRRTMILSVLSSPALVSGLMVVRAKNPVHSVLFPIL
VFCDTSGLLILLGLDFSAMISPVVHIGAIAVSFLFVVMMFNIQIAEIHEE
VLRYLPVSGIIGLIFWWEMFFILDNETIPLLPTHRNTTSLRYTVYAGKVR
SWTNLETLGNLLYTYYSVWFLVSSLILLVAMIGAIVLTMHRTTKVKRQDV
FRRNALDSRSHIMNRTISPFGHSHRRSFSSGAGGPPDNYKETFKMWI
Structure From Source
NC_007579
Source Exons
1744
Corresponding Protein
NC_007579_31.protseq
Gene
nad6
Gene Product
nad6
Remark
DB_xref: GI:81176537
DB_xref: GeneID:3800098
Feature: CDS: locus_tag = 'TraeoMp37'; protein_id = 'YP_398421.1'; On complementary strand.
Feature: CDS: locus_tag = 'TraeoMp37'; protein_id = 'YP_398421.1'; ; On complementary strand.
Gene: nad6
Codon Start
1