Query (optional)   in Class  

GrainGenes Sequence Report: U66376_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
U66376_1.cds
Peptide
MTGGTAEKLQSSEPTQGIVETITDGVTKGVKELVVGEKPRVVPKPGDGQK
IYEIDPTLKDFRSHLDYRYREYKRIRAAIDQHEGGLEAFSRGYEKLGFTR
SAEGITYREWAPGAHSAALVGDFNNWNPNADAMTRDDYGVWEIFLPNNAD
GSSAIPHGSRVKIRMDTPSGVKDSISAWIKFSVQAPGEIPFNGIYYDPPE
EEKYVFQHPQPKRPESLRIYESHIGMSSPEPKINSYANFRDEVLPRIKRL
GYNAVQIMAIQEHSYYASFGYHVTNFFAPSSRFGTPEDLKSLIDRAHELG
LLVLMDIVHSHSSNNTLDGLNGFDGTDTHYFHGGPRGHHWMWDSRLFNYG
SWEVLRFLLSNARWWLEEYNFDGFRFDGVTSMMYTHHGLQMTFTGNYGEY
FGFATDVDAVVYLMLVNDLIHGLYPDAVSIGEDVSGMPTFCIPVPDGGVG
FDYRLHMAVADKWIELLKQSDESWKMGDIVHTLTNKRWLEKCVTYAESHD
QALVGDKTIAFWLMDKDMYDFMALDRPSTPRIDRGIALHKMIRLVTMGLG
GESYLNFMGNEFGHPEWIDFPRGPQTLPTGKVLPGNNNNYDKCRRRFDLG
DAEFLRYRGMQEFDQAMQHLEEKYGFMTSEHQYVSRKHEEDKVIIFERGD
LVFVFNFHWSNSFFDYRVGCSKPGKYKVALDSDDALFGGFSRLDHDVDYF
TTEHPHDNRPRSFSVYTPSRTAVVYALTE
Structure From Source
U66376
Source Exons
12190
DB Remark
2.4.1.18
Corresponding Protein
U66376_1.protseq
Gene Product
1,4-alpha-D-glucan 6-alpha-D-(1,4-alpha-D-glucanotransferase
Remark
CDS note: branching enzyme
DB_xref: GI:1620662
Feature: CDS: protein_id = 'AAB17086.1';
Codon Start
1