Query (optional)   in Class  

GrainGenes Sequence Report: X07931_1.cds

[Submit comment/correction]

Sequence
X07931_1.cds
Peptide
MAALATSQLATSGTVLGVTDRFRRPGFQGLRPRNPADAALGMRTIGASAA
PKQSRKAHRGSRRCLSVVVSATGSGMNLVFVGAEMAPWSKTGGLGDVLGG
LPPAMAANGHRVMVVSPRYDQYKDAWDTSVISEIKVADEYERVRFFHCYK
RGVDRVFIDHPWFLEKVRGKTKEKIYGPDAGTDYEDNQQRFSLLCQAALE
APRILNLNNNPYFSGPYGEDVVFVCNDWHTGLLACYLKSNYQSNGIYRTA
KVAFCIHNISYQGRFSFDDFAQLNLPDRFKSSFDFIDGYDKPVEGRKINW
MKAGILQADKVLTVSPYYAEELISGEARGCELDNIMRLTGITGIVNGMDV
SEWDPTKDKFLAVNYDITTALEAKALNKEALQAEVGLPVDRKVPLVAFIG
RLEEQKGPDVMIAAIPEILKEEDVQIILLGTGKKKFEKLLKSMEEKFPGK
VRAVVRFNAPLAHQMMAGADLLAVTSRFEPCGLIQLQGMRYGTPCVCAST
GGLVDTIVEGKTGFHMGRLSVDCNVVEPADVKKVATTLKRAVKVVGTPAY
QEMVKNCMIQDLSWKGPAKNWEDVLLELGVEGSEPGIVGEEIAPLAMENV
AAP
Structure From Source
X07931
Source Exons
1318
[ Show all 11 ]
Corresponding Protein
X07931_1.protseq
Gene Product
starch synthase
Remark
DB_xref: GI:295809
DB_xref: SWISS-PROT:P09842
Feature: CDS: protein_id = 'CAA30755.1';
Codon Start
1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.