Query (optional)   in Class  

GrainGenes Sequence Report: X17637_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
X17637_1.cds
Peptide
MATTRFPSLLFYSYIFLLCNGSMAQLFGQSFTPWQSSRQGGLRGCRFDRL
QAFEPLRQVRSQAGIIEYFDEQNEQFRCAGVSVIRRVIEPQGLLLPQYHN
APGLVYILQGRGFTGLTFPGCPATFQQQFQPFDQAQFAEGQSQSQNLKDE
HQRVHHIKQGDVVALPAGIVHWCYNDGDAPIVAVYVFDVNNNANQLEPRQ
KEFLLAGNNKREQQFGQNIFSGFSVQLLSEALGISQQVAQKIQSQNDQRG
EIIRVSQGLQFLKPFVSQQGPVEHQAYQPIQSQEEQSTQYQVGQSPQYQE
GQSTQYQPGQSWDQSFNGLEENFCSLEARQNIENPKRADTYNPRAGRITH
LNSKNFPTLNLVQMSATRVNLYQNAILSPYWNINAHSVMHMIQGRARVQV
VNNHGQTVFNDILRRGQLLIIPQHYVVLKKAEREGCQYISFKTNPNSMVS
QIAGKTSILRALPVDVLANAYRISRQEAQNLKNNRGEEFDAFTPKFTQTG
SQSYQDEGESSSTEKASE
Structure From Source
X17637
Source Exons
1328
446720
8471362
14631900
Corresponding Protein
X17637_1.protseq
Gene Product
12S seed storage protein
Remark
DB_xref: GI:313360
[ Show all 11 ]
Codon Start
1