Query (optional)   in Class  

GrainGenes Sequence Report: X75036_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
X75036_1.cds
Peptide
MTTRNGQIKNFTSNSGPQHPAAHGVSRSVLEMNGEVVERAEPHIGSLHRG
TEKLIEYKTYLQALPYFDRLDYVSTMAQEHAHSSAVERLLNCEVPLRAQY
IRVLFCEITRISNHSLASTTHAMDVGASTPFLWAFEEREKLLEFYERVPG
ARMHASFIRPGGVAQDLPLGLCRDIDSSTQQFASRIDELEEMSTGNRIWK
QRLVDIGTVTAQQAKDWGFSGVMLRGPGVCWDSRRAAPYDVHDQSDLDVP
VGTRGDRYDRYCIRIEEMRQSVRIIVQCPNQMPSGMIKADDRKLCPPSRS
RMKLSMESSIHHFELYTEGFSVPAPSTYTAVEAPKGEFGVFLVSNGSNRP
YRCKIRAPGFAHSQGLDSMSKHHMPADVVTIIGTQDIVFGEVDR
Structure From Source
X75036
Source Exons
1143
9571025
23372803
38014044
57446005
Corresponding Protein
X75036_1.protseq
Gene Product
NADH dehydrogenase
Remark
CDS note: subunit 7
[ Show all 6 ]
Codon Start
1