Query (optional)   in Class  

GrainGenes Sequence Report: X76737_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
X76737_1.cds
Peptide
MATTSFPSVLFYSCIFLLYNGSMAQLFGQSFTPWQSSRQGGLKGCKFDRL
QAFEPLRQVRSQAGVTEYFDEQNEQLRCTGVSVIRRVIEPQGLLLPQYHN
APGLVYLLQGRGFTGLTLPGCPAAFQQQFQPFDRAQGQSQSHLKDEHQRV
HRFKQGDVIALPAGIVHWGYNDGDAPVVAIYVFDVNNNANQLEPRQKEFL
LAGNNKEDQQFGQNIFSGFNIQLLSEALGISQQAAQRIQSQKEQRGEIIR
VTQRLQFLKPTMSQQDRSFNGLEENFCSLEAKQNIENPKRADTYNPRAGR
ITRLHGQNFPILNLVQMSATRVNLYQNAILSPFWNINAHSVVYMIQGHAR
VQVVNNNGQTVFNDRLRQGQLLILPQHYVVLKKTEREGCQYISFKTNPNS
MVSHIAGKSSILRALPVNVLANAYRISRQEVRNLKNNRGQESGVFTPKFT
QTSFQPYPEGEDESSLINKASE
Structure From Source
X76737
Source Exons
11419
Corresponding Protein
X76737_1.protseq
Gene
12s globulin
Gene Product
12s globulin
Remark
DB_xref: GI:2764798
[ Show all 13 ]
Codon Start
1