Query (optional)   in Class  

GrainGenes Sequence Report: Y08625_1.cds

[ Submit comment/correction ]

Sequence
Y08625_1.cds
Peptide
MSKSCDGAKTEWPELVGCTIKEAKEKIKADRPDLKVVIVPVGSIVTQEID
LNRVRVWVDKVAKVPKIG
Structure From Source
Y08625
Source Exons
1207
Corresponding Protein
Y08625_1.protseq
Gene Product
subtilisin-chymotrypsin inhibitor 2
Remark
DB_xref: GI:1617121
[ Show all 7 ]
Codon Start
1

GrainGenes is a product of the Agricultural Research Service of the US Department of Agriculture.