Query (optional)   in Class  

GrainGenes Sequence Report: Z15131_1.cds

Sequence
Z15131_1.cds
Peptide
MASQGVASMFALALLLGAFASIPQSVESIGVCYGMSANNLPAASTVVGMF
KSNGINSMRLYAPDQAALQAVGGTGVNVVVGAPNDVLSALAASPAAAASW
VRSNIQAYPKVSFRYVCVGNEVAGGATQNLLPAMQNVQGALASAGLGHIK
VTTSVSQAILGVYSPPSAGSFTGEADAFMGPVVQFLARTGSPLMANIYPY
LAWAYNPSAMDMSYALFTASGTVVQDGAYGYQNLFDTTVDAFYTAMGKHG
GAGVKLVVSESGWPSAGGEAATPANARIYNQYLINHVGRGTPRHPGGIET
YVFAMFNENQKDNGVEQNWGLFYPNMQHVYPISF
Structure From Source
Z15131
Source Exons
11005
DB Remark
3.2.1.73
Corresponding Protein
Z15131_1.protseq
Gene Product
(1-3, 1-4)-beta-glucanase
Remark
DB_xref: GI:288654
[ Show all 10 ]
Codon Start
1