Query (optional)   in Class  

GrainGenes Sequence Report: Z15131_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
Z15131_1.cds
Peptide
MASQGVASMFALALLLGAFASIPQSVESIGVCYGMSANNLPAASTVVGMF
KSNGINSMRLYAPDQAALQAVGGTGVNVVVGAPNDVLSALAASPAAAASW
VRSNIQAYPKVSFRYVCVGNEVAGGATQNLLPAMQNVQGALASAGLGHIK
VTTSVSQAILGVYSPPSAGSFTGEADAFMGPVVQFLARTGSPLMANIYPY
LAWAYNPSAMDMSYALFTASGTVVQDGAYGYQNLFDTTVDAFYTAMGKHG
GAGVKLVVSESGWPSAGGEAATPANARIYNQYLINHVGRGTPRHPGGIET
YVFAMFNENQKDNGVEQNWGLFYPNMQHVYPISF
Structure From Source
Z15131
Source Exons
11005
DB Remark
3.2.1.73
Corresponding Protein
Z15131_1.protseq
Gene Product
(1-3, 1-4)-beta-glucanase
Remark
[ Hide all but 1 of 10 ]
DB_xref: GI:288654
DB_xref: GOA:Q42518
DB_xref: InterPro:IPR000490
DB_xref: UniProt/TrEMBL:Q42518
DB_xref: TrEMBL:Q42518
DB_xref: HSSP:P12257
DB_xref: UniProtKB/TrEMBL:Q42518
Feature: CDS: function = 'hydrolysis of (1-3,1-4)-beta-glucan'; citation = [1]; evidence = experimental; protein_id = 'CAA78834.1'
Feature: CDS: function = 'hydrolysis of (1-3,1-4)-beta-glucan'; /citation = [1]; /evidence = experimental; /protein_id = 'CAA78834.1'
Feature: CDS: function = 'hydrolysis of (1-3,1-4)-beta-glucan'; experiment = 'experimental evidence, no additional details recorded'; citation = [1]; protein_id = 'CAA78834.1';
Codon Start
1