Query (optional)   in Class  

GrainGenes Sequence Report: Z22874_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
Z22874_1.cds
Peptide
MASQGVASMFALALLLGAFASIPQSVESIGVCYGMSANNLPAASTVVSMF
KSNGINSMRLYAPDQAALQAVGGTGVNVVVGAPNDVLSNLAASPAAAASW
VRSNIQAYPKVSFRYVCVGNEVAGGATQNLVPAMKNVQGALASAGLGHIK
VTTSVSQAILGVYSPPSAGSFTGEADAFMGPVVQFLARTGAPLMANIYPY
LAWAYNPSAMDMSYALFTASGTVVQDGSYGYQNLFDTTVDAFYTAMAKHG
GSNVKLVVSESGWPSGGGTAATPANARIYNQYLINHVGRGTPRHPGAIET
YVFSMFNENQKDSGVEQNWGLFYPNMQHVYPISF
Structure From Source
Z22874
Source Exons
11005
DB Remark
3.2.1.73
Corresponding Protein
Z22874_1.protseq
Gene Product
(1,3;1,4) beta glucanase
Remark
DB_xref: GI:311764
[ Show all 8 ]
Codon Start
1