Query (optional)   in Class  

GrainGenes Sequence Report: A21630_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
A21630_1.cds
Peptide
MAASLQAAATLMPAKIGGRASSARPSSHVARAFGVDAGARITCSLQSDIR
EVASKCADAAKMAGFALATSALLVSGATA
Structure From Source
A21630
Source Exons
1237
Corresponding Protein
A21630_1.protseq
Remark
DB_xref: GI:579235
Feature: CDS: protein_id = 'CAA01566.1';
Gene: pre-sequence wheat 33K
Codon Start
1