Query (optional)   in Class  

GrainGenes Sequence Report: A21632_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
A21632_1.cds
Peptide
MAASLQAAATLMPAKIGGRASSARPSSHVARAFGVDAGARITCSLQSDIR
EVASKCADAAKMAGFALATSALLVSGATAEGAPKRLTFDEIQSKTYMEVK
GTGTA
Structure From Source
A21632
Source Exons
1315
Corresponding Protein
A21632_1.protseq
Remark
DB_xref: GI:579237
Feature: CDS: protein_id = 'CAA01567.1';
Gene: wheat 33K
Codon Start
1