Query (optional)   in Class  

GrainGenes Sequence Report: D00206_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
D00206_1.cds
Peptide
MSPQTETKAGVGFKAGVKDYKLTYYTPEYETKDTDILAAFRVSPQPGVPP
EEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGEDSQWICY
VAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPTYSKTFQG
PPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRACYECLRGGLDFT
KDDENVNSQPFMRWRDRFVFCAEAIYKSQAETGEIKGHYLNATAGTCEEM
IKRAVFARELGVPIVMHDYLTGGFTANTTLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRMSGGDHIHSGTVVGKLEGEREMTLGFVDLLR
DDFIEKDRARGIFFTQDWVSMPGVIPVASGGIHVWHMPALTEIFGDDSVL
QFGGGTLGHPWGNAPGAAANRVALEACVQARNEGRDLAREGNEIIRAACK
WSPELAAACEVWKAIKFEFEPVDTIDK
Structure From Source
D00206
Source Exons
11434
Corresponding Protein
D00206_1.protseq
Gene Product
ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit (H-type)
Remark
CDS note: Rubisco LS
DB_xref: GI:344053
Feature: CDS: transl_table = 11; protein_id = 'BAA00146.1';
Gene: rbcL
Codon Start
1