Query (optional)   in Class  

GrainGenes Sequence Report: J01236_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
J01236_1.cds
Peptide
MGKNGSLCCFSLLLLLLLAGLASGHQVLFQGFNWESWKQSGGWYNMMMGK
VDDIAAAGVTHVWLPPPSHSVSNEGYMPGRLYDIDASKYGNAAELKSLIG
ALHGKGVQAIADIVINHRCADYKDSRGIYCIFEGGTSDGRLDWGPHMICR
DDTKYSDGTANLDTGADFAAAPDIDHLNDRVQRELKEWLLWLKSDLGFDA
WRLDFARGYSPEMAKVYIDGTSPSLAVAEVWDNMATGGDGKPNYDQDAHR
QNLVNWVDKVGGAASAGMVFDFTTKGILNAAVEGELWRLIDPQGKAPGVM
GWWPAKAATFVDNHDTGSTQAMWPFPSDKVMQGYAYILTHPGIPCIFYDH
FFNWGFKDQIAALVAIRKRNGITATSALKILMHEGDAYVAEIDGKVVVKI
GSRYDVGAVIPAGFVTSAHGNDYAVWEKNGAAATLQRS
Structure From Source
J01236
Source Exons
11317
Corresponding Protein
J01236_1.protseq
Remark
CDS note: alpha-amylase type A, EC 3.2.1.1
DB_xref: GI:166987
Feature: CDS: protein_id = 'AAA32929.1';
Codon Start
1