Query (optional)   in Class  

GrainGenes Sequence Report: J01458_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
J01458_1.cds
Peptide
MNPLIAAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIR
GTLLLSLAFMEALTIYGLVVALALLFANPFV
Structure From Source
J01458
Source Exons
1246
Corresponding Protein
J01458_1.protseq
Remark
CDS note: ATP synthase proton-translocating subunit
DB_xref: GI:343673
Feature: CDS: protein_id = 'AAA84724.1';
Codon Start
1