Query (optional)   in Class  

GrainGenes Sequence Report: J02817_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
J02817_1.cds
Peptide
MATTPRLASLLLLLALCAAAAGALRLPPDASFPGAQAERLIRALNLLPGR
PRRGLGAGAEDVAPGQLLERRVTLPGLPEGVGDLGHHAGYYRLPNTHDAR
MFYFFFESRGKKEDPVVIWLTGGPGCSSELAVFYENGPFTIANNMSLVWN
KFGWDKISNIIFVDPATGTGFSYSSDDRDTRHDEAGVSNDLYDFLQVFFK
KHPEFVKNDFFITGESYAGHYIPAFASRVHQGNKKNEGTHINLKGFAIGN
GLTDPAIQYKAYTDYALDMNLIQKADYDRINKFIPPCEFAIKLCGTDGKA
SCMAAYMVCNSIFNSIMKLVGTKNYYDVRKECEGKLCYDFSNLEKFFGDK
AVRQAIGVGDIEFVSCSTSVYQAMLTDWMRNLEVGIPALLEDGINVLIYA
GEYDLICNWLGNSRWVHSMEWSGQKDFAKTAESSFLVDDAQAGVLKSHGA
LSFLKVHNAGHMVPMDQPKAALEMLRRFTQGKLKESVPEEEPATTFYAAI
Structure From Source
J02817
Source Exons
1299
[ Show all 9 ]
Corresponding Protein
J02817_1.protseq
Remark
CDS note: gibberellin responsive protein
DB_xref: GI:170704
Feature: CDS: protein_id = 'AAA34273.1';
Codon Start
1