Query (optional)   in Class  

GrainGenes Sequence Report: J02961_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
J02961_1.cds
Peptide
QRCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQA
GGKTCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPN
NLCCSQWGYCGLGSEFCGEGCQNGACSTDKPCGKDAGGRVCTNNYCCSKW
GSCGIGPGYCGAGCQSGGCDGVFAEAIATNSTLLAE
Structure From Source
J02961
Source Exons
1561
Corresponding Protein
J02961_1.protseq
Remark
CDS note: wheat germ agglutinin
DB_xref: GI:170668
Feature: CDS: protein_id = 'AAA34257.1';
Codon Start
1