Query (optional)   in Class  

GrainGenes Sequence Report: J03897_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
J03897_1.cds
Peptide
GGPGCSSFDGFVYEHGPFNFESGGSVKSLPKLHLNPYAWSKVSTMIYLDS
PAGVGLSYSKNVSDYETGDLKTATDSHTFLLKWFQLYPEFLSNPFYIAGE
SYAGVYVPTLSHEVVKGIQGGAKPTINFKGYMVGNGVCDTIFDGNALVPF
AHGMGLISDEIYQQASTSCHGNYWNATDGKCDTAISKIESLISGLNIYDI
LEPCYHSRSIKEVNLQNSKLPQSFKDLGTTNKPFPVRTRMLGRAWPLRAP
VKAGRVPSWQEVASGVPCMSDEVATAWLDNAAVRSAIHAQSVSAIGPWLL
CTDKLYFVHDAGSMIAYHKNLTSQGYRAIIFSGDHDMCVPFTGSEAWTKS
LGYGVVDSWRPWITNGQVSGYTEGYEHGLTFATIKGAGHTVPEYKPQEAF
AFYSRWLAGSKL
Structure From Source
J03897
Source Exons
11239
Corresponding Protein
J03897_1.protseq
Remark
CDS note: carboxypeptidase I precursor
DB_xref: GI:167012
Feature: CDS: protein_id = 'AAA32940.1';
Codon Start
1