Query (optional)   in Class  

GrainGenes Sequence Report: J04202_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
J04202_1.cds
Peptide
MANKHMSLSLFIVLLGLSCSLASGQVLFQGFNWESWKHNGGWYNFLMGKV
DDIAAAGVTHVWLPPASQSVAEQGYMPGRLYDLDASKYGNKAQLKSLIGA
LHGKGVKAIADIVINHRTAERKDGRGIYCIFEGGTPDARLDWGPHMICRD
DRPYADGTGNPDTGADFGAAPDIDHLNPRVQKELVEWLNWLRTDVGFDGW
RFDFAKGYSADVAKIYVDRSEPSFAVAEIWTSLAYGGDGKPNLNQDPHRQ
ELVNWVNKVGGSGPATTFDFTTKGILNVAVEGELWRLRGTDGKAPGMIGW
WPAKAVTFVDNHDTGSTQHMWPFPSDRVMQGYAYILTHPGTPCIFYDHFF
DWGLKEEIDRLVSIRTRQGIHSESKLQIMEADADLYLAEIDGKVIVKLGP
RYDVGHLIPEGFKVVAHGNDYAVWEKV
Structure From Source
J04202
Source Exons
187
1911135
12421493
DB Remark
3.2.1.1
Corresponding Protein
J04202_1.protseq
Gene Product
alpha-amylase
Remark
CDS note: precursor
DB_xref: GI:166985
Feature: CDS: protein_id = 'AAA98615.1';
Gene: Amy46
Codon Start
1