Query (optional)   in Class  

GrainGenes Sequence Report: J04954_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
J04954_1.cds
Peptide
MFLLHEYDIFWTFLIIASLIPILAFSISGLLAPVSEGPEKLSSYESGIEP
MGGAWVQFRIRYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEALIF
VLILVVGLVYAWRKGALEWS
Structure From Source
J04954
Source Exons
1363
Corresponding Protein
J04954_1.protseq
Gene Product
NADPH-plastoquinone oxireductase
Remark
DB_xref: GI:556459
Feature: CDS: protein_id = 'AAA84730.1';
Gene: ndhC
Codon Start
1