Query (optional)   in Class  

GrainGenes Sequence Report: J04954_2.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
J04954_2.cds
Peptide
MVLTEYLDKKKEGKDSIETVMNLIEFPLLDQTSSNSVISTTPNDLSNWSR
LSSLWPLLYGTSCCFIEFASLIGSRFDFDRYGLVPRSSPRQADLILTAGT
VTMKMAPSLVRLYEQMPEPKYVIAMGACTITGGMFSTDSYSTVRGVDKLI
PVDVYLPGCPPKPEAVIDALTKLRKKISREIVEDRTLSQNKNRCFTTSHK
LYVRRSTHTGTYEQELLYQSPSTLDISSETFFKSKSSVPSYKLVN
Structure From Source
J04954
Source Exons
1738
Corresponding Protein
J04954_2.protseq
Gene Product
thylakoid membrane protein
Remark
DB_xref: GI:556460
Feature: CDS: protein_id = 'AAA84731.1';
Gene: psbG
Codon Start
1