Query (optional)   in Class  

GrainGenes Sequence Report: J05104_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
J05104_1.cds
Peptide
MTDLNLPSIFVPLVGLVFPAIAMTSLFLYVQKKKIV
Structure From Source
J05104
Source Exons
1111
Corresponding Protein
J05104_1.protseq
Gene Product
photosystem I subunit
Remark
DB_xref: GI:336419
Feature: CDS: protein_id = 'AAA84050.1';
Gene: psaI
Codon Start
1