Query (optional)   in Class  

GrainGenes Sequence Report: J05104_2.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
J05104_2.cds
Peptide
MNWRSEHIWVELLKGSRKRSNFFWACILFLGSLGFLLVGTSSYLGKNIIS
ILPSQEILFFPQGVVMSFYGIAGLFISSYLWCTILWNVGSGYDRFDRKEG
IVCIFRWGFPGIKRRVFLRFLMRDIQSIRI
Structure From Source
J05104
Source Exons
1391
Corresponding Protein
J05104_2.protseq
Gene Product
unknown protein
Remark
CDS note: ORF; putative
DB_xref: GI:895609
Feature: CDS: protein_id = 'AAA84051.1';
Codon Start
1