Query (optional)   in Class  

GrainGenes Sequence Report: J05486_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
J05486_1.cds
Peptide
MKNFLILALLSMAATMATAQFDPSEQYQPYPEQQQPILQQQLLLQQQQQM
LLQQQPLLQVLQQQLNPCRQFLVQQCSPVAAVSFLRSQILQQSSCQVMRQ
QCCRRLEQIPEQLRCPAIHSVVQAIIMQQQQQQFFQPQMQQQFFQPQMQQ
VTQGIFQPQMQQVTQGIFQTQMQGQIEGMRAFALQALPAMCDVYVPPHCP
VATTPLSGF
Structure From Source
J05486
Source Exons
1630
Corresponding Protein
J05486_1.protseq
Remark
CDS note: seed storage protein
DB_xref: GI:166568
Feature: CDS: protein_id = 'AAA32721.1'
Codon Start
1