Query (optional)   in Class  

GrainGenes Sequence Report: L07941_1.cds

Sequence
L07941_1.cds
Peptide
MAQFWAEGSLEKNNALVEYLKQYGVVRTDKVAEVMETIDRALFVPEGFTP
YTDSPMPIGYNATISAPHMHATCLELLKDYLQPGMHALDVGSGSGYLTAC
FAMMVGPEGRAVGIEHIPELVVASTENVERSAAAALMKDGSLSFHVSDGR
LGWPDAAPYDAIHVGAAAPEIPRPLLEQLKPGGRMVIPVGTYSQDLQVID
KSADGSTSVRNDASVRYVPLTSRSAQLQDS
Structure From Source
L07941
Source Exons
1693
DB Remark
2.1.1.77
Corresponding Protein
L07941_1.protseq
Gene Product
L-isoaspartyl methyltransferase
Remark
DB_xref: GI:414332
Feature: CDS: partial; protein_id = 'AAA34297.1';
Codon Start
1