Query (optional)   in Class  

GrainGenes Sequence Report: L11873_1.cds

Sequence
L11873_1.cds
Peptide
MAPEMEEGTLEIGMEYRTVSGVAGPLVILDKVKGPKYQEIVNIRLGDGTT
RRGQVLEVDGEKAVVQVFEGTSGIDNKYTTVQFTGEVLKTPVSLDMLGRI
FNGSGKPIDNGPPILPEAYLDISGSSINPSERTYPEEMIQTGISTIDVMN
SIARGQKIPLFSAAGLPHNEIAAQICRQAGLVKRLEQSKHAAEGGEEDNF
AIVFAAMGVNMETAQFFKRDFEENGSMERVTLFLNLANDPTIERIITPRI
ALTTAEYLAYECGKHVLVILTDMSSYADALREVSAAREEVPGRRGYPGYM
YTDLATIYERAGRIEGRKGSITQIPILTMPNDDITHPTPDLTGYITEGQI
YIDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRRDHSDVSNQLYANYA
IGKDVQAMKAVVGEEALSSEDLLYLEFLDKFERKFVAQGAYDTRNIFQSL
DLAWTLLRIFPRELLHRIPAKTLDQFYSRDATH
Structure From Source
L11873
Source Exons
11452
Corresponding Protein
L11873_1.protseq
Gene Product
vacuolar ATPase B subunit
Remark
CDS note: putative
DB_xref: GI:167110
Feature: CDS: function = 'proton pumping ATPase'; standard_name = 'V ATPase B subunit'; protein_id = 'AAA81331.1';
Codon Start
1