Query (optional)   in Class  

GrainGenes Sequence Report: L11880_1.cds

Sequence
L11880_1.cds
Peptide
MGMCSDKKRSSPGVALWCVVLGIALLVVDAAGSEGRARAGQLAEEHGDAA
YCSALCKGRSQSDFGPCYNECLYGRVTGQEEARGAGGVGGPAGLLEMPTK
RVGREEEEKTKQGDATVRLSDPVWCYDACREHPELDYNQCVNDCYAENMP
DAAWLVAHGGTGGEEARGGVVDVPMGVVQHEAAAGALSRGNCDEYCRKHY
DEGSPGYRHCQYMCPRLRVHGVAEGEEARGGAVDGLTVVGKPHCDWFRDC
SVTPCVWRCGKRVQEEDNEGTRTGALNVLAAARHEVAVGACSSTVYVQSC
YACCQREVTRDPDFDWYACIRSCDDKDAIPIKKERENKKDGVVPPVK
Structure From Source
L11880
Source Exons
11044
Corresponding Protein
L11880_1.protseq
Remark
DB_xref: GI:170789
Feature: CDS: function = ''unknown''; protein_id = 'AAA50847.1';
Gene: wali2
Codon Start
1