Query (optional)   in Class  

GrainGenes Sequence Report: L12707_1.cds

Sequence
L12707_1.cds
Peptide
MASQLSAMTSVPQFHGLRTYSSPRSMATLPSLRRRRSQGIRCDYIGSSTN
LIMVTTTTLMLFAGRFGLAPSANRKATAGLKLEARESGLQTGDPAGFTLA
DTLACGAVGHIMGVGIVLGLKNTGVLDQIIG
Structure From Source
L12707
Source Exons
1396
Corresponding Protein
L12707_1.protseq
Gene Product
photosystem I PSI-K subunit
Remark
DB_xref: GI:304220
Feature: CDS: function = 'unknown'; evidence = experimental; protein_id = 'AAA03043.1';
Gene: Psak
Codon Start
1