Query (optional)   in Class  

GrainGenes Sequence Report: L06607_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
L06607_1.cds
Peptide
MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVG
CKRCESACPTDFLSVRVYLGPETTRSMALSY
Structure From Source
L06607
Source Exons
1246
Corresponding Protein
L06607_1.protseq
Gene Product
photosystem I subunit C
Remark
DB_xref: GI:167038
Feature: CDS: function = 'binds two 4Fe-4S clusters'; evidence = experimental; protein_id = 'AAA32953.1';
Gene: PsaC
Codon Start
1