Query (optional)   in Class  

GrainGenes Sequence Report: L07604_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
L07604_1.cds
Peptide
MAEAAALEGSEPVDLTKHPSGIIPTLQNIVSTVNLDCKLDLKAIALQARN
AEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEQQSKLAARKYAR
IIQKLGFPAKFKDFKIQNIVASCDVKFPIRLEGLAYSHGAFSSYEPELFP
GLIYRMRQPKIVLLIFVSGKIVLTGAKVREETYSAFENIYPVLTEFRKVQ
Q
Structure From Source
L07604
Source Exons
1606
Corresponding Protein
L07604_1.protseq
Gene Product
DNA-binding protein
Remark
DB_xref: GI:170778
Feature: CDS: function = 'transcription'; evidence = experimental; protein_id = 'AAA34307.1';
Gene: TFIID
Label: TBP
Codon Start
1