Query (optional)   in Class  

GrainGenes Sequence Report: L10332_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
L10332_1.cds
Peptide
MTNMVRWLFSTSRFTAFYLHFCIKFPYIYDFLLFSICLFFFLVRFISIIL
LPICNLFGASFIITLPPEIQDPQALAHLAGLNFYLSLYEQDPGWVTFIQN
ELNHNTPLEDIPGRLKLFLMEEKLSSMRQDVIQEFVALYQRIGPYLPIEP
YLVDEALRSYLDHIHATDSFTVLQASYQDLRENEGGSVFFRDAVSHNRDL
LEAESSARRCLEVEQRIRWEEIPKSKASLERAEHEHALDLFKSEDLRREL
EKKRAG
Structure From Source
L10332
Source Exons
1771
Corresponding Protein
L10332_1.protseq
Remark
CDS note: putative
DB_xref: GI:170759
Feature: CDS: standard_name = 'ORF256'; protein_id = 'AAA34299.1';
Codon Start
1