Query (optional)   in Class  

GrainGenes Sequence Report: L10365_1.cds

[ Printable Version ]  [ Submit comment/correction ]

Sequence
L10365_1.cds
Peptide
MTNMVRWLFSTSRFTAFYLHFCIKFPYIYDFLLFSICLFFFLVRFISIIL
LPICNLFGASFIITLPPEIQDPQALAHLAGLNFYLSLYEQDPGWVTFIQN
ELNHNTPLEDIPGRLKLFLMEEKLSSMRQDVIQEFVALYQRIGPYLPIEP
YLVDEALRSYLDHIHATDSFTVLQASYQDLRENEGGSVFFRDAVSHNRDL
LEAESSARRCLEVEQRIRWEEIPKSKASLERAEHEHALDLFKSEDLRREL
EKKRAG
Structure From Source
L10365
Source Exons
1771
Corresponding Protein
L10365_1.protseq
Gene Product
unknown
Remark
DB_xref: GI:903886
Feature: CDS: standard_name = 'ORF256'; protein_id = 'AAA70327.1';
Codon Start
1